PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g028265m
Common NameCISIN_1g021378mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 212aa    MW: 24559.1 Da    PI: 5.6782
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g028265mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.55.5e-141141911696
                        EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                        ++ p +fa ++  + e sk + ++ +sgr+W++ + +++  g+++l+kGW +  +  +L egD+++F+l+++++  ++++v
  orange1.1g028265m 114 VYAPARFAYQY--VDEDSKSVEVQAPSGRKWSLGI-HWRATGGFFLAKGWAGVSDYVHLTEGDICIFELVRHRDVVFKLHV 191
                        56688999666..4557889***************.7888899*************************9976665455555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-1395193IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-1496193IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.1199195IPR003340B3 DNA binding domain
PfamPF023627.8E-12113192IPR003340B3 DNA binding domain
CDDcd100173.40E-11117192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTACEIDYPY EDDMACEMCV EISEEQFKHE AELLSRKRKM EDGLERDEPN AEPDLLVSLR  60
KSGIYITEKY KELYSTEELE RAVYIARAFK ATNPKPNPLF MIIWKANDKP CREVYAPARF  120
AYQYVDEDSK SVEVQAPSGR KWSLGIHWRA TGGFFLAKGW AGVSDYVHLT EGDICIFELV  180
RHRDVVFKLH VFHQCSKITS WREKFSLVSI I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13439SRKRKM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.104891e-121fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388635.11e-157PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067DLP91e-158A0A067DLP9_CITSI; Uncharacterized protein
TrEMBLA0A067DEF91e-158A0A067DEF9_CITSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-12B3 family protein